Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 4096174..4096800 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P64926 |
| Locus tag | MR259_RS19155 | Protein ID | WP_003410075.1 |
| Coordinates | 4096402..4096800 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A806JLL8 |
| Locus tag | MR259_RS19150 | Protein ID | WP_003911750.1 |
| Coordinates | 4096174..4096401 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS19140 | 4094213..4094557 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
| MR259_RS19145 | 4094746..4095915 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
| MR259_RS19150 | 4096174..4096401 | + | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MR259_RS19155 | 4096402..4096800 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
| MR259_RS19160 | 4096983..4097414 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| MR259_RS19165 | 4097515..4097949 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
| MR259_RS19170 | 4098386..4098565 | - | 180 | Protein_3787 | hypothetical protein | - |
| MR259_RS19175 | 4098653..4099273 | + | 621 | WP_003410086.1 | IS110 family transposase | - |
| MR259_RS19180 | 4099227..4099817 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
| MR259_RS19185 | 4099945..4101201 | - | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
| MR259_RS19190 | 4101555..4101755 | + | 201 | Protein_3791 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T295196 WP_003410075.1 NZ_OW052189:4096402-4096800 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|