Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 4072435..4073021 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLY3 |
| Locus tag | MR259_RS19050 | Protein ID | WP_003410010.1 |
| Coordinates | 4072435..4072779 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL58 |
| Locus tag | MR259_RS19055 | Protein ID | WP_003410014.1 |
| Coordinates | 4072773..4073021 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS19015 | 4068141..4068740 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
| MR259_RS19020 | 4069156..4069584 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
| MR259_RS19025 | 4069810..4070349 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
| MR259_RS19030 | 4070869..4071429 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
| MR259_RS19035 | 4071426..4071767 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
| MR259_RS19040 | 4071853..4072110 | + | 258 | WP_003410006.1 | hypothetical protein | - |
| MR259_RS19045 | 4072011..4072346 | - | 336 | WP_003410009.1 | dehydrogenase | - |
| MR259_RS19050 | 4072435..4072779 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
| MR259_RS19055 | 4072773..4073021 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| MR259_RS19060 | 4073121..4075436 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
| MR259_RS19065 | 4075433..4075705 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
| MR259_RS19070 | 4075758..4076114 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
| MR259_RS19075 | 4076271..4077038 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T295195 WP_003410010.1 NZ_OW052189:c4072779-4072435 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|