Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 4063543..4064231 | Replicon | chromosome |
Accession | NZ_OW052189 | ||
Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | MR259_RS18985 | Protein ID | WP_003409958.1 |
Coordinates | 4063543..4063962 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | MR259_RS18990 | Protein ID | WP_003409968.1 |
Coordinates | 4063971..4064231 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR259_RS18965 | 4059038..4059886 | + | 849 | WP_003901306.1 | class I SAM-dependent methyltransferase | - |
MR259_RS18970 | 4059849..4061294 | - | 1446 | WP_003899115.1 | APC family permease | - |
MR259_RS18975 | 4061473..4062159 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
MR259_RS18980 | 4062350..4063318 | - | 969 | WP_003899116.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
MR259_RS18985 | 4063543..4063962 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR259_RS18990 | 4063971..4064231 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR259_RS18995 | 4064374..4066050 | + | 1677 | WP_003899118.1 | PecA family PE domain-processing aspartic protease | - |
MR259_RS19000 | 4066038..4066691 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
MR259_RS19005 | 4066806..4067036 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
MR259_RS19010 | 4067121..4068032 | - | 912 | WP_031716369.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
MR259_RS19015 | 4068141..4068740 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T295193 WP_003409958.1 NZ_OW052189:c4063962-4063543 [Mycobacterium tuberculosis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |