Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 4037315..4037859 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag MR259_RS18835 Protein ID WP_003409896.1
Coordinates 4037315..4037611 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag MR259_RS18840 Protein ID WP_003409899.1
Coordinates 4037608..4037859 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS18780 4032348..4032698 - 351 WP_003409871.1 hypothetical protein -
MR259_RS18785 4032709..4033611 - 903 WP_003899097.1 hypothetical protein -
MR259_RS18790 4033632..4033823 - 192 WP_003409876.1 hypothetical protein -
MR259_RS18795 4033824..4034120 - 297 WP_003409877.1 hypothetical protein -
MR259_RS18800 4034360..4034575 + 216 WP_003409878.1 antitoxin -
MR259_RS18805 4034572..4034883 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
MR259_RS18810 4034857..4035378 - 522 WP_003904745.1 hypothetical protein -
MR259_RS18815 4035353..4035730 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
MR259_RS18820 4035772..4036221 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
MR259_RS18825 4036218..4036763 + 546 WP_003409891.1 SecB-like chaperone -
MR259_RS18830 4036652..4037266 - 615 WP_003901296.1 hypothetical protein -
MR259_RS18835 4037315..4037611 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MR259_RS18840 4037608..4037859 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
MR259_RS18845 4037846..4038340 + 495 WP_003899099.1 hypothetical protein -
MR259_RS18850 4038500..4038907 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
MR259_RS18855 4038911..4039183 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
MR259_RS18860 4039216..4040436 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
MR259_RS18865 4041335..4042132 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T295192 WP_003409896.1 NZ_OW052189:c4037611-4037315 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT295192 WP_003409899.1 NZ_OW052189:c4037859-4037608 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References