Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 4028278..4028981 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLK7 |
| Locus tag | MR259_RS18745 | Protein ID | WP_003409778.1 |
| Coordinates | 4028278..4028607 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TLK8 |
| Locus tag | MR259_RS18750 | Protein ID | WP_003409780.1 |
| Coordinates | 4028604..4028981 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS18725 | 4024661..4025731 | + | 1071 | WP_003902252.1 | epoxide hydrolase EphB | - |
| MR259_RS18730 | 4025728..4026243 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
| MR259_RS18735 | 4026240..4027301 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| MR259_RS18740 | 4027298..4028068 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
| MR259_RS18745 | 4028278..4028607 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| MR259_RS18750 | 4028604..4028981 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
| MR259_RS18755 | 4028978..4029568 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
| MR259_RS18760 | 4029623..4030987 | + | 1365 | WP_003903691.1 | HNH endonuclease signature motif containing protein | - |
| MR259_RS18765 | 4031142..4031594 | - | 453 | WP_003899095.1 | lipoprotein | - |
| MR259_RS18770 | 4031658..4032059 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| MR259_RS18775 | 4032052..4032234 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| MR259_RS18780 | 4032348..4032698 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| MR259_RS18785 | 4032709..4033611 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| MR259_RS18790 | 4033632..4033823 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T295190 WP_003409778.1 NZ_OW052189:c4028607-4028278 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT295190 WP_003409780.1 NZ_OW052189:c4028981-4028604 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|