Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3788396..3789009 | Replicon | chromosome |
Accession | NZ_OW052189 | ||
Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA2 |
Locus tag | MR259_RS17660 | Protein ID | WP_003408465.1 |
Coordinates | 3788396..3788785 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | MR259_RS17665 | Protein ID | WP_003408469.1 |
Coordinates | 3788782..3789009 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR259_RS17625 | 3784025..3784939 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
MR259_RS17630 | 3784942..3785772 | + | 831 | WP_003408448.1 | cyclase family protein | - |
MR259_RS17635 | 3785772..3786122 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
MR259_RS17640 | 3786175..3786993 | + | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
MR259_RS17645 | 3787007..3787786 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
MR259_RS17655 | 3788217..3788348 | + | 132 | Protein_3483 | IS3 family transposase | - |
MR259_RS17660 | 3788396..3788785 | - | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR259_RS17665 | 3788782..3789009 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
MR259_RS17670 | 3789227..3790711 | + | 1485 | WP_003408473.1 | biotin carboxylase | - |
MR259_RS17675 | 3790708..3791955 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
MR259_RS17680 | 3791998..3792417 | - | 420 | WP_003408483.1 | hypothetical protein | - |
MR259_RS17685 | 3792407..3793117 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T295188 WP_003408465.1 NZ_OW052189:c3788785-3788396 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUI9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAN9 |