Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3536854..3537470 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TJ74 |
| Locus tag | MR259_RS16565 | Protein ID | WP_003407593.1 |
| Coordinates | 3537153..3537470 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TJ73 |
| Locus tag | MR259_RS16560 | Protein ID | WP_003900349.1 |
| Coordinates | 3536854..3537156 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS16550 | 3532740..3534587 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
| MR259_RS16555 | 3534588..3536840 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
| MR259_RS16560 | 3536854..3537156 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
| MR259_RS16565 | 3537153..3537470 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
| MR259_RS16570 | 3537467..3538471 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
| MR259_RS16575 | 3538524..3539813 | + | 1290 | WP_003902090.1 | serine hydrolase domain-containing protein | - |
| MR259_RS16580 | 3539886..3540503 | - | 618 | WP_003407606.1 | class I SAM-dependent methyltransferase | - |
| MR259_RS16585 | 3540717..3540929 | - | 213 | WP_003898900.1 | dodecin family protein | - |
| MR259_RS16590 | 3540990..3541388 | + | 399 | WP_003900351.1 | hypothetical protein | - |
| MR259_RS16595 | 3541433..3542461 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T295186 WP_003407593.1 NZ_OW052189:3537153-3537470 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|