Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3230206..3230894 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0THR7 |
| Locus tag | MR259_RS15215 | Protein ID | WP_003406304.1 |
| Coordinates | 3230463..3230894 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0THR6 |
| Locus tag | MR259_RS15210 | Protein ID | WP_003406302.1 |
| Coordinates | 3230206..3230466 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS15190 | 3225783..3226607 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
| MR259_RS15195 | 3226612..3227793 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
| MR259_RS15200 | 3227870..3228970 | - | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
| MR259_RS15205 | 3229141..3230130 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
| MR259_RS15210 | 3230206..3230466 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
| MR259_RS15215 | 3230463..3230894 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR259_RS15220 | 3230917..3232500 | - | 1584 | WP_009940130.1 | PE family protein | - |
| MR259_RS15225 | 3232680..3233540 | + | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
| MR259_RS15230 | 3233621..3234451 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| MR259_RS15235 | 3234508..3234801 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
| MR259_RS15240 | 3234798..3235067 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T295182 WP_003406304.1 NZ_OW052189:3230463-3230894 [Mycobacterium tuberculosis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|