Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3083983..3084551 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag MR259_RS14545 Protein ID WP_003405865.1
Coordinates 3084177..3084551 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag MR259_RS14540 Protein ID WP_003405863.1
Coordinates 3083983..3084180 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS14520 3080024..3080662 - 639 WP_003898730.1 lipid droplet-associated protein -
MR259_RS14525 3080752..3081759 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
MR259_RS14530 3081776..3082759 - 984 WP_003898731.1 hypothetical protein -
MR259_RS14535 3082822..3083895 + 1074 WP_003898732.1 redox-regulated ATPase YchF -
MR259_RS14540 3083983..3084180 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR259_RS14545 3084177..3084551 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
MR259_RS14550 3084754..3085452 + 699 WP_242382542.1 hypothetical protein -
MR259_RS14555 3085570..3085755 + 186 WP_003901093.1 hypothetical protein -
MR259_RS14560 3085682..3085957 - 276 WP_003405867.1 hypothetical protein -
MR259_RS14565 3086200..3086523 + 324 WP_003405871.1 putative quinol monooxygenase -
MR259_RS14570 3086538..3087236 - 699 WP_031646953.1 hypothetical protein -
MR259_RS14575 3087270..3087479 + 210 WP_003911400.1 hypothetical protein -
MR259_RS14580 3087431..3088201 - 771 Protein_2875 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T295181 WP_003405865.1 NZ_OW052189:3084177-3084551 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT295181 WP_003405863.1 NZ_OW052189:3083983-3084180 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References