Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
| Location | 2859076..2859695 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | - |
| Locus tag | MR259_RS13415 | Protein ID | WP_003404726.1 |
| Coordinates | 2859261..2859695 (+) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | P9WJ06 |
| Locus tag | MR259_RS13410 | Protein ID | WP_003898641.1 |
| Coordinates | 2859076..2859255 (+) | Length | 60 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS13395 | 2854549..2856129 | + | 1581 | WP_003910977.1 | serine hydrolase | - |
| MR259_RS13400 | 2856126..2858519 | + | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
| MR259_RS13405 | 2858792..2858950 | + | 159 | WP_003404720.1 | hypothetical protein | - |
| MR259_RS13410 | 2859076..2859255 | + | 180 | WP_003898641.1 | antitoxin | Antitoxin |
| MR259_RS13415 | 2859261..2859695 | + | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
| MR259_RS13420 | 2859793..2860566 | + | 774 | WP_003404735.1 | VOC family protein | - |
| MR259_RS13425 | 2860631..2861080 | + | 450 | WP_003404738.1 | hypothetical protein | - |
| MR259_RS13430 | 2861215..2861445 | - | 231 | WP_003898642.1 | hypothetical protein | - |
| MR259_RS13435 | 2861612..2863120 | - | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
| MR259_RS13440 | 2863122..2864360 | - | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T295178 WP_003404726.1 NZ_OW052189:2859261-2859695 [Mycobacterium tuberculosis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|