Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 2597675..2598308 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag MR259_RS12065 Protein ID WP_003403365.1
Coordinates 2597675..2598058 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag MR259_RS12070 Protein ID WP_003403368.1
Coordinates 2598153..2598308 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS12040 2592967..2593503 + 537 WP_003403341.1 50S ribosomal protein L10 -
MR259_RS12045 2593540..2593932 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
MR259_RS12050 2593925..2594620 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
MR259_RS12055 2594691..2596196 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
MR259_RS12060 2596277..2597287 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
MR259_RS12065 2597675..2598058 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
MR259_RS12070 2598153..2598308 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR259_RS12075 2598384..2599100 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
MR259_RS12080 2599376..2599684 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
MR259_RS12085 2599671..2599916 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
MR259_RS12090 2600026..2600463 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
MR259_RS12095 2600460..2600714 - 255 WP_003911263.1 antitoxin VapB7 -
MR259_RS12100 2600828..2603191 + 2364 WP_003901895.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T295173 WP_003403365.1 NZ_OW052189:c2598058-2597675 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT295173 WP_003403368.1 NZ_OW052189:c2598308-2598153 [Mycobacterium tuberculosis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References