Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 2560548..2561197 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67241 |
| Locus tag | MR259_RS11880 | Protein ID | WP_003403236.1 |
| Coordinates | 2560802..2561197 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ34 |
| Locus tag | MR259_RS11875 | Protein ID | WP_003403235.1 |
| Coordinates | 2560548..2560802 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS11850 | 2555674..2555757 | + | 84 | Protein_2342 | galactose-1-phosphate uridylyltransferase | - |
| MR259_RS11855 | 2555776..2556857 | + | 1082 | Protein_2343 | galactose-1-phosphate uridylyltransferase | - |
| MR259_RS11860 | 2556854..2557945 | + | 1092 | WP_003900977.1 | galactokinase | - |
| MR259_RS11865 | 2558340..2559404 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
| MR259_RS11870 | 2559508..2560455 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| MR259_RS11875 | 2560548..2560802 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
| MR259_RS11880 | 2560802..2561197 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
| MR259_RS11885 | 2561291..2562031 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
| MR259_RS11890 | 2562163..2562423 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MR259_RS11895 | 2562420..2562827 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR259_RS11900 | 2562899..2564050 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
| MR259_RS11905 | 2564143..2565870 | - | 1728 | WP_003901883.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T295171 WP_003403236.1 NZ_OW052189:2560802-2561197 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4XGR | |
| PDB | 4XGQ |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 4XGR | |
| PDB | 4XGQ | |
| AlphaFold DB | A0A7U4BSC2 |