Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2554920..2555545 | Replicon | chromosome |
Accession | NZ_OW052189 | ||
Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | MR259_RS11845 | Protein ID | WP_003403218.1 |
Coordinates | 2555144..2555545 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ36 |
Locus tag | MR259_RS11840 | Protein ID | WP_003403213.1 |
Coordinates | 2554920..2555147 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR259_RS11815 | 2550099..2550320 | - | 222 | WP_242382540.1 | DUF4926 domain-containing protein | - |
MR259_RS11820 | 2550462..2551067 | + | 606 | WP_003898526.1 | hypothetical protein | - |
MR259_RS11825 | 2551086..2553653 | - | 2568 | WP_003901879.1 | SEC-C metal-binding domain-containing protein | - |
MR259_RS11830 | 2553737..2554486 | + | 750 | WP_003898528.1 | hypothetical protein | - |
MR259_RS11835 | 2554483..2554725 | + | 243 | WP_003403210.1 | hypothetical protein | - |
MR259_RS11840 | 2554920..2555147 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
MR259_RS11845 | 2555144..2555545 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
MR259_RS11850 | 2555674..2555757 | + | 84 | Protein_2342 | galactose-1-phosphate uridylyltransferase | - |
MR259_RS11855 | 2555776..2556857 | + | 1082 | Protein_2343 | galactose-1-phosphate uridylyltransferase | - |
MR259_RS11860 | 2556854..2557945 | + | 1092 | WP_003900977.1 | galactokinase | - |
MR259_RS11865 | 2558340..2559404 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
MR259_RS11870 | 2559508..2560455 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T295170 WP_003403218.1 NZ_OW052189:2555144-2555545 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC9 |