Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2547382..2548025 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag MR259_RS11795 Protein ID WP_003403187.1
Coordinates 2547624..2548025 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag MR259_RS11790 Protein ID WP_003403184.1
Coordinates 2547382..2547627 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS11755 2542662..2543192 - 531 WP_003917320.1 two component system sensor kinase HK2 -
MR259_RS11760 2543176..2543871 - 696 WP_003918099.1 two-component system response regulator TcrA -
MR259_RS11765 2543994..2544305 + 312 WP_003403164.1 hypothetical protein -
MR259_RS11770 2544377..2545327 + 951 WP_003900184.1 DUF1259 domain-containing protein -
MR259_RS11775 2545568..2546152 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
MR259_RS11780 2546154..2546864 + 711 Protein_2328 IS607 family element RNA-guided endonuclease TnpB -
MR259_RS11785 2546867..2547337 + 471 WP_003898523.1 hypothetical protein -
MR259_RS11790 2547382..2547627 + 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR259_RS11795 2547624..2548025 + 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
MR259_RS11800 2548016..2548195 + 180 Protein_2332 hypothetical protein -
MR259_RS11805 2548613..2548810 - 198 WP_003403191.1 hypothetical protein -
MR259_RS11810 2548890..2550047 - 1158 WP_003898524.1 hypothetical protein -
MR259_RS11815 2550099..2550320 - 222 WP_242382540.1 DUF4926 domain-containing protein -
MR259_RS11820 2550462..2551067 + 606 WP_003898526.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T295169 WP_003403187.1 NZ_OW052189:2547624-2548025 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT295169 WP_003403184.1 NZ_OW052189:2547382-2547627 [Mycobacterium tuberculosis]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References