Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/AbrB(antitoxin) |
| Location | 2541292..2541938 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ88 |
| Locus tag | MR259_RS11740 | Protein ID | WP_003403137.1 |
| Coordinates | 2541292..2541705 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ89 |
| Locus tag | MR259_RS11745 | Protein ID | WP_003403139.1 |
| Coordinates | 2541702..2541938 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS11720 | 2537375..2538925 | + | 1551 | WP_003905349.1 | MCE family protein | - |
| MR259_RS11725 | 2538977..2539369 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | - |
| MR259_RS11730 | 2539366..2539623 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | - |
| MR259_RS11735 | 2539806..2541041 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
| MR259_RS11740 | 2541292..2541705 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR259_RS11745 | 2541702..2541938 | - | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | Antitoxin |
| MR259_RS11750 | 2542042..2542548 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
| MR259_RS11755 | 2542662..2543192 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| MR259_RS11760 | 2543176..2543871 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| MR259_RS11765 | 2543994..2544305 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| MR259_RS11770 | 2544377..2545327 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
| MR259_RS11775 | 2545568..2546152 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| MR259_RS11780 | 2546154..2546864 | + | 711 | Protein_2328 | IS607 family element RNA-guided endonuclease TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14786.14 Da Isoelectric Point: 8.1405
>T295168 WP_003403137.1 NZ_OW052189:c2541705-2541292 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|