Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 2541292..2541938 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag MR259_RS11740 Protein ID WP_003403137.1
Coordinates 2541292..2541705 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag MR259_RS11745 Protein ID WP_003403139.1
Coordinates 2541702..2541938 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS11720 2537375..2538925 + 1551 WP_003905349.1 MCE family protein -
MR259_RS11725 2538977..2539369 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
MR259_RS11730 2539366..2539623 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
MR259_RS11735 2539806..2541041 - 1236 WP_003403128.1 ATP-binding protein -
MR259_RS11740 2541292..2541705 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
MR259_RS11745 2541702..2541938 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
MR259_RS11750 2542042..2542548 - 507 WP_003900973.1 two component system sensor kinase HK1 -
MR259_RS11755 2542662..2543192 - 531 WP_003917320.1 two component system sensor kinase HK2 -
MR259_RS11760 2543176..2543871 - 696 WP_003918099.1 two-component system response regulator TcrA -
MR259_RS11765 2543994..2544305 + 312 WP_003403164.1 hypothetical protein -
MR259_RS11770 2544377..2545327 + 951 WP_003900184.1 DUF1259 domain-containing protein -
MR259_RS11775 2545568..2546152 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
MR259_RS11780 2546154..2546864 + 711 Protein_2328 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T295168 WP_003403137.1 NZ_OW052189:c2541705-2541292 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT295168 WP_003403139.1 NZ_OW052189:c2541938-2541702 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References