Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2521846..2522465 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O53779 |
| Locus tag | MR259_RS11660 | Protein ID | WP_003403047.1 |
| Coordinates | 2522058..2522465 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | O53778 |
| Locus tag | MR259_RS11655 | Protein ID | WP_003403039.1 |
| Coordinates | 2521846..2522061 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS11645 | 2520374..2521132 | + | 759 | WP_003898511.1 | Mut7-C RNAse domain-containing protein | - |
| MR259_RS11650 | 2521261..2521752 | - | 492 | WP_003403017.1 | mycobacterial cell wall protein Rv0580c | - |
| MR259_RS11655 | 2521846..2522061 | + | 216 | WP_003403039.1 | type II toxin-antitoxin system antitoxin VapB26 | Antitoxin |
| MR259_RS11660 | 2522058..2522465 | + | 408 | WP_003403047.1 | type II toxin-antitoxin system toxin ribonuclease C26 | Toxin |
| MR259_RS11665 | 2522525..2523211 | - | 687 | WP_003403052.1 | LpqN/LpqT family lipoprotein | - |
| MR259_RS11670 | 2523365..2525998 | + | 2634 | WP_003403055.1 | GH92 family glycosyl hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14471.43 Da Isoelectric Point: 4.4493
>T295166 WP_003403047.1 NZ_OW052189:2522058-2522465 [Mycobacterium tuberculosis]
VIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDYLVATRVGVDAELAVLRELAGGAWELANCGAAEIEQ
AARIVTKYQDQRIGIADAANVVLADRYRTRTILTLDRRHFSALRPIGGGRFTVIP
VIIDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDYLVATRVGVDAELAVLRELAGGAWELANCGAAEIEQ
AARIVTKYQDQRIGIADAANVVLADRYRTRTILTLDRRHFSALRPIGGGRFTVIP
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 5X3T |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 5X3T | |
| AlphaFold DB | A0A7U4BSA2 |