Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
| Location | 2484373..2485049 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPQ9 |
| Locus tag | MR259_RS11490 | Protein ID | WP_003898500.1 |
| Coordinates | 2484373..2484786 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TPR0 |
| Locus tag | MR259_RS11495 | Protein ID | WP_003402915.1 |
| Coordinates | 2484783..2485049 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14667.78 Da Isoelectric Point: 7.3603
>T295165 WP_003898500.1 NZ_OW052189:c2484786-2484373 [Mycobacterium tuberculosis]
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|