Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Rv0299-vapB/- |
| Location | 2207676..2208247 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | Rv0299 | Uniprot ID | - |
| Locus tag | MR259_RS10185 | Protein ID | WP_003401560.1 |
| Coordinates | 2207676..2207978 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | O07227 |
| Locus tag | MR259_RS10190 | Protein ID | WP_003401563.1 |
| Coordinates | 2208026..2208247 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS10165 | 2203145..2203948 | - | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
| MR259_RS10170 | 2203958..2205355 | - | 1398 | WP_003401544.1 | sulfatase | - |
| MR259_RS10175 | 2205534..2207309 | + | 1776 | WP_010886074.1 | PE family protein | - |
| MR259_RS10180 | 2207452..2207679 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
| MR259_RS10185 | 2207676..2207978 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
| MR259_RS10190 | 2208026..2208247 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
| MR259_RS10195 | 2208244..2208669 | + | 426 | WP_003401566.1 | PIN domain nuclease | - |
| MR259_RS10200 | 2208805..2209437 | + | 633 | WP_003905275.1 | TetR/AcrR family transcriptional regulator | - |
| MR259_RS10205 | 2209434..2210342 | + | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
| MR259_RS10210 | 2210350..2210940 | - | 591 | WP_229298012.1 | hypothetical protein | - |
| MR259_RS10215 | 2210933..2210983 | - | 51 | Protein_2017 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T295162 WP_003401560.1 NZ_OW052189:2207676-2207978 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|