Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
| Location | 2207452..2207978 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | Rv0299 | Uniprot ID | - |
| Locus tag | MR259_RS10185 | Protein ID | WP_003401560.1 |
| Coordinates | 2207676..2207978 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | Rv0298 | Uniprot ID | P9WJ08 |
| Locus tag | MR259_RS10180 | Protein ID | WP_003401555.1 |
| Coordinates | 2207452..2207679 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T295161 WP_003401560.1 NZ_OW052189:2207676-2207978 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|