Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 1131054..1131728 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag MR259_RS05430 Protein ID WP_003417282.1
Coordinates 1131054..1131482 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag MR259_RS05435 Protein ID WP_003417286.1
Coordinates 1131486..1131728 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS05405 1126876..1127277 - 402 WP_003417264.1 cytidine deaminase -
MR259_RS05410 1127514..1127852 + 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
MR259_RS05415 1127849..1128283 + 435 WP_003902441.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
MR259_RS05420 1128412..1130184 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
MR259_RS05425 1130184..1130975 + 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
MR259_RS05430 1131054..1131482 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
MR259_RS05435 1131486..1131728 - 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
MR259_RS05440 1131850..1132464 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
MR259_RS05445 1132461..1133126 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
MR259_RS05450 1133127..1133660 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
MR259_RS05455 1133657..1134031 - 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
MR259_RS05460 1134128..1135132 - 1005 WP_003914475.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T295156 WP_003417282.1 NZ_OW052189:c1131482-1131054 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT295156 WP_003417286.1 NZ_OW052189:c1131728-1131486 [Mycobacterium tuberculosis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References