Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 554575..555179 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag MR259_RS02815 Protein ID WP_003414492.1
Coordinates 554575..554967 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag MR259_RS02820 Protein ID WP_003414495.1
Coordinates 554964..555179 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS02785 549725..550513 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
MR259_RS02790 550847..551392 - 546 WP_014584866.1 DUF1802 family protein -
MR259_RS02795 551664..552548 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
MR259_RS02800 552551..553438 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
MR259_RS02805 553743..554288 - 546 WP_003910939.1 DUF1802 family protein -
MR259_RS02810 554285..554554 - 270 WP_003414489.1 DUF2277 family protein -
MR259_RS02815 554575..554967 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
MR259_RS02820 554964..555179 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
MR259_RS02825 555226..555975 + 750 WP_003902358.1 enoyl-CoA hydratase -
MR259_RS02830 556054..557136 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
MR259_RS02835 557129..558439 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
MR259_RS02840 558442..559269 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
MR259_RS02845 559266..560177 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T295152 WP_003414492.1 NZ_OW052189:c554967-554575 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT295152 WP_003414495.1 NZ_OW052189:c555179-554964 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References