Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 534377..534947 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | MR259_RS02690 | Protein ID | WP_003414166.1 |
| Coordinates | 534377..534733 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | MR259_RS02695 | Protein ID | WP_003901465.1 |
| Coordinates | 534717..534947 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS02670 | 529832..531520 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
| MR259_RS02675 | 531524..531850 | - | 327 | WP_003414157.1 | hypothetical protein | - |
| MR259_RS02680 | 532023..532607 | + | 585 | WP_031705940.1 | DUF3558 family protein | - |
| MR259_RS02685 | 532626..534275 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
| MR259_RS02690 | 534377..534733 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| MR259_RS02695 | 534717..534947 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
| MR259_RS02700 | 534990..536033 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| MR259_RS02705 | 536032..536499 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
| MR259_RS02710 | 536675..536929 | - | 255 | WP_003917684.1 | hypothetical protein | - |
| MR259_RS02715 | 537077..537481 | + | 405 | WP_003414181.1 | hypothetical protein | - |
| MR259_RS02720 | 537478..537669 | + | 192 | WP_003414184.1 | hypothetical protein | - |
| MR259_RS02725 | 537886..538146 | + | 261 | Protein_533 | transposase | - |
| MR259_RS02730 | 539256..539513 | + | 258 | WP_003899489.1 | hypothetical protein | - |
| MR259_RS02735 | 539618..539929 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T295150 WP_003414166.1 NZ_OW052189:c534733-534377 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|