Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 494798..495485 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag MR259_RS02470 Protein ID WP_003414064.1
Coordinates 495090..495485 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag MR259_RS02465 Protein ID WP_003414061.1
Coordinates 494798..495064 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS02435 490437..491339 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
MR259_RS02440 491408..492160 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
MR259_RS02450 492404..492679 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
MR259_RS02455 492676..494298 - 1623 WP_003414057.1 class I SAM-dependent DNA methyltransferase -
MR259_RS02460 494385..494801 - 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
MR259_RS02465 494798..495064 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR259_RS02470 495090..495485 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
MR259_RS02475 495482..495751 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
MR259_RS02480 495761..496855 - 1095 WP_003414068.1 restriction endonuclease subunit S -
MR259_RS02485 496852..497271 - 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
MR259_RS02490 497270..497344 + 75 Protein_486 hypothetical protein -
MR259_RS02495 497345..497824 - 480 WP_003414073.1 dihydrofolate reductase -
MR259_RS02500 497895..498695 - 801 WP_003911953.1 thymidylate synthase -
MR259_RS02505 498851..499588 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T295149 WP_003414064.1 NZ_OW052189:c495485-495090 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT295149 WP_003414061.1 NZ_OW052189:c495064-494798 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References