Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 355396..356110 | Replicon | chromosome |
Accession | NZ_OW052189 | ||
Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | MR259_RS01635 | Protein ID | WP_003413460.1 |
Coordinates | 355670..356110 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ20 |
Locus tag | MR259_RS01630 | Protein ID | WP_003413456.1 |
Coordinates | 355396..355683 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR259_RS01595 | 350818..351063 | + | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
MR259_RS01600 | 351060..351464 | + | 405 | WP_003413432.1 | type II toxin-antitoxin system VapC family toxin | - |
MR259_RS01605 | 351681..352301 | + | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
MR259_RS01610 | 352312..352806 | + | 495 | WP_003413444.1 | DUF2617 family protein | - |
MR259_RS01615 | 352803..353234 | + | 432 | WP_003899390.1 | DUF4247 domain-containing protein | - |
MR259_RS01620 | 353259..353717 | + | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
MR259_RS01625 | 353714..355285 | + | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
MR259_RS01630 | 355396..355683 | + | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
MR259_RS01635 | 355670..356110 | + | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR259_RS01640 | 356131..356886 | - | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
MR259_RS01645 | 357019..357615 | - | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
MR259_RS01650 | 357623..358468 | - | 846 | WP_003413466.1 | acyl-CoA thioesterase II | - |
MR259_RS01655 | 358497..359396 | - | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
MR259_RS01660 | 359524..360198 | + | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T295146 WP_003413460.1 NZ_OW052189:355670-356110 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BWB8 |