Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 293933..294564 | Replicon | chromosome |
| Accession | NZ_OW052189 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ28 |
| Locus tag | MR259_RS01360 | Protein ID | WP_003413174.1 |
| Coordinates | 294187..294564 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | MR259_RS01355 | Protein ID | WP_003413167.1 |
| Coordinates | 293933..294190 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR259_RS01325 | 289848..290162 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| MR259_RS01330 | 290458..291669 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
| MR259_RS01335 | 291796..292455 | + | 660 | WP_003902296.1 | LppA family lipoprotein | - |
| MR259_RS01340 | 292452..293114 | + | 663 | WP_003905878.1 | LppA family lipoprotein | - |
| MR259_RS01345 | 293111..293388 | + | 278 | Protein_262 | type II toxin-antitoxin system VapB family antitoxin | - |
| MR259_RS01350 | 293481..293894 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
| MR259_RS01355 | 293933..294190 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
| MR259_RS01360 | 294187..294564 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR259_RS01365 | 294580..294954 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| MR259_RS01370 | 295054..295449 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| MR259_RS01375 | 295446..295691 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| MR259_RS01380 | 296102..296521 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| MR259_RS01385 | 296533..297342 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
| MR259_RS01390 | 297339..298592 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| MR259_RS01395 | 298585..299097 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T295144 WP_003413174.1 NZ_OW052189:294187-294564 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ28 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |