Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 293481..294190 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag MR259_RS01350 Protein ID WP_003413164.1
Coordinates 293481..293894 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag MR259_RS01355 Protein ID WP_003413167.1
Coordinates 293933..294190 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS01320 288535..289740 - 1206 WP_003413027.1 chorismate synthase -
MR259_RS01325 289848..290162 + 315 WP_009937839.1 hypothetical protein -
MR259_RS01330 290458..291669 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
MR259_RS01335 291796..292455 + 660 WP_003902296.1 LppA family lipoprotein -
MR259_RS01340 292452..293114 + 663 WP_003905878.1 LppA family lipoprotein -
MR259_RS01345 293111..293388 + 278 Protein_262 type II toxin-antitoxin system VapB family antitoxin -
MR259_RS01350 293481..293894 + 414 WP_003413164.1 PIN domain nuclease Toxin
MR259_RS01355 293933..294190 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
MR259_RS01360 294187..294564 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
MR259_RS01365 294580..294954 - 375 WP_003413177.1 hypothetical protein -
MR259_RS01370 295054..295449 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
MR259_RS01375 295446..295691 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
MR259_RS01380 296102..296521 - 420 WP_003413190.1 A24 family peptidase -
MR259_RS01385 296533..297342 - 810 WP_003413193.1 shikimate dehydrogenase -
MR259_RS01390 297339..298592 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
MR259_RS01395 298585..299097 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T295143 WP_003413164.1 NZ_OW052189:293481-293894 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT295143 WP_003413167.1 NZ_OW052189:293933-294190 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References