Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 279603..280243 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag MR259_RS01265 Protein ID WP_003412970.1
Coordinates 279603..280022 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag MR259_RS01270 Protein ID WP_003412975.1
Coordinates 280019..280243 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS01235 275193..275915 - 723 WP_003412957.1 DUF1906 domain-containing protein -
MR259_RS01240 276432..276654 + 223 Protein_241 type II toxin-antitoxin system VapB family antitoxin -
MR259_RS01245 276651..277052 + 402 WP_003412963.1 PIN domain-containing protein -
MR259_RS01250 277087..278007 - 921 WP_003412965.1 restriction endonuclease -
MR259_RS01255 278348..278554 - 207 WP_229298035.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
MR259_RS01260 278652..279602 + 951 WP_003911916.1 ERCC4 domain-containing protein -
MR259_RS01265 279603..280022 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
MR259_RS01270 280019..280243 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
MR259_RS01275 280274..283109 - 2836 Protein_248 amino acid decarboxylase -
MR259_RS01280 283181..283582 - 402 WP_003412981.1 hypothetical protein -
MR259_RS01285 283582..284052 - 471 WP_003899364.1 transcription antitermination factor NusB -
MR259_RS01290 284055..284618 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T295142 WP_003412970.1 NZ_OW052189:c280022-279603 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT295142 WP_003412975.1 NZ_OW052189:c280243-280019 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References