Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PhRel-ATphRel/- |
Location | 4357325..4358375 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | phRel | Uniprot ID | - |
Locus tag | MR221_RS20340 | Protein ID | WP_242363193.1 |
Coordinates | 4357554..4358375 (-) | Length | 274 a.a. |
Antitoxin (Protein)
Gene name | ATphRel | Uniprot ID | A0A7U4BTV8 |
Locus tag | MR221_RS20335 | Protein ID | WP_003407167.1 |
Coordinates | 4357325..4357561 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS20320 | 4353295..4354764 | - | 1470 | WP_003900326.1 | cytochrome b5 domain-containing protein | - |
MR221_RS20325 | 4354960..4355745 | - | 786 | WP_003407180.1 | lipoprotein LprF | - |
MR221_RS20330 | 4356048..4357253 | + | 1206 | WP_003918234.1 | serine hydrolase domain-containing protein | - |
MR221_RS20335 | 4357325..4357561 | - | 237 | WP_003407167.1 | hypothetical protein | Antitoxin |
MR221_RS20340 | 4357554..4358375 | - | 822 | WP_242363193.1 | GTP pyrophosphokinase family protein | Toxin |
MR221_RS20345 | 4358596..4358982 | + | 387 | WP_003904611.1 | anti-sigma-F factor antagonist RsfA | - |
MR221_RS20350 | 4359121..4361082 | + | 1962 | WP_003407159.1 | sigma-F factor regulator | - |
MR221_RS20355 | 4361373..4362158 | + | 786 | WP_003407157.1 | membrane protein | - |
MR221_RS20360 | 4362155..4362817 | + | 663 | WP_003407152.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 274 a.a. Molecular weight: 30086.03 Da Isoelectric Point: 5.5817
>T295140 WP_242363193.1 NZ_OW052188:c4358375-4357554 [Mycobacterium tuberculosis]
VVVALVGSAIVDLHSRPPWSNNAVRRLGVALRDGVDPPVDCPSYAEVMLWHADLAAEVQDRIEGRSWSASELLVTSRAKS
QDTLLAKLRRRPYLQLNTIQDIAGVRIDADLLLGEQTRLAREIADHFGADQPAIHDLRDHPHAGYRAVHVWLRLPAGRVE
IQIRTILQSLWANFYELLADAYGRGIRYDERPEQLAAGVVPAQLQELVGVMQDASADLAMHEAEWQHCAEIEYPGQRAMA
LGEASKNNATVLATTKFRLERAINEAESAGGGG
VVVALVGSAIVDLHSRPPWSNNAVRRLGVALRDGVDPPVDCPSYAEVMLWHADLAAEVQDRIEGRSWSASELLVTSRAKS
QDTLLAKLRRRPYLQLNTIQDIAGVRIDADLLLGEQTRLAREIADHFGADQPAIHDLRDHPHAGYRAVHVWLRLPAGRVE
IQIRTILQSLWANFYELLADAYGRGIRYDERPEQLAAGVVPAQLQELVGVMQDASADLAMHEAEWQHCAEIEYPGQRAMA
LGEASKNNATVLATTKFRLERAINEAESAGGGG
Download Length: 822 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|