Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4323356..4324011 | Replicon | chromosome |
| Accession | NZ_OW052188 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A7U4FAR1 |
| Locus tag | MR221_RS20190 | Protein ID | WP_003407268.1 |
| Coordinates | 4323610..4324011 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TIK2 |
| Locus tag | MR221_RS20185 | Protein ID | WP_003407272.1 |
| Coordinates | 4323356..4323613 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR221_RS20165 | 4318543..4320510 | - | 1968 | WP_003407285.1 | primosomal protein N' | - |
| MR221_RS20170 | 4320591..4321328 | - | 738 | WP_031647000.1 | lysoplasmalogenase | - |
| MR221_RS20175 | 4321327..4322289 | + | 963 | WP_003407279.1 | alpha/beta hydrolase | - |
| MR221_RS20180 | 4322314..4323273 | + | 960 | WP_015631299.1 | alpha/beta hydrolase | - |
| MR221_RS20185 | 4323356..4323613 | + | 258 | WP_003407272.1 | CopG family transcriptional regulator | Antitoxin |
| MR221_RS20190 | 4323610..4324011 | + | 402 | WP_003407268.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR221_RS20195 | 4324266..4325996 | + | 1731 | WP_031653809.1 | PE family protein | - |
| MR221_RS20200 | 4326042..4327076 | - | 1035 | WP_003407264.1 | AraC family transcriptional regulator | - |
| MR221_RS20205 | 4327154..4328539 | + | 1386 | WP_003407260.1 | cytochrome P450 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14894.39 Da Isoelectric Point: 11.6897
>T295139 WP_003407268.1 NZ_OW052188:4323610-4324011 [Mycobacterium tuberculosis]
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FAR1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TIK2 |