Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3950155..3950768 | Replicon | chromosome |
| Accession | NZ_OW052188 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFA2 |
| Locus tag | MR221_RS18525 | Protein ID | WP_003408465.1 |
| Coordinates | 3950379..3950768 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ52 |
| Locus tag | MR221_RS18520 | Protein ID | WP_003408469.1 |
| Coordinates | 3950155..3950382 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR221_RS18500 | 3946047..3946757 | + | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
| MR221_RS18505 | 3946747..3947166 | + | 420 | WP_003408483.1 | hypothetical protein | - |
| MR221_RS18510 | 3947209..3948456 | - | 1248 | WP_003408476.1 | serine hydrolase | - |
| MR221_RS18515 | 3948453..3949937 | - | 1485 | WP_003904684.1 | biotin carboxylase | - |
| MR221_RS18520 | 3950155..3950382 | + | 228 | WP_003408469.1 | antitoxin | Antitoxin |
| MR221_RS18525 | 3950379..3950768 | + | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR221_RS18530 | 3950816..3950947 | - | 132 | Protein_3664 | IS3 family transposase | - |
| MR221_RS18540 | 3951378..3952157 | - | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
| MR221_RS18545 | 3952171..3952989 | - | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
| MR221_RS18550 | 3953042..3953392 | - | 351 | WP_003898986.1 | cupin domain-containing protein | - |
| MR221_RS18555 | 3953392..3954222 | - | 831 | WP_003408448.1 | cyclase family protein | - |
| MR221_RS18560 | 3954225..3955139 | - | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T295136 WP_003408465.1 NZ_OW052188:3950379-3950768 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BUI9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7E4J | |
| AlphaFold DB | A0A7U4FAN9 |