Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3695625..3696328 | Replicon | chromosome |
| Accession | NZ_OW052188 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLK7 |
| Locus tag | MR221_RS17395 | Protein ID | WP_003409778.1 |
| Coordinates | 3695999..3696328 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TLK8 |
| Locus tag | MR221_RS17390 | Protein ID | WP_003409780.1 |
| Coordinates | 3695625..3696002 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR221_RS17350 | 3690783..3690974 | + | 192 | WP_003409876.1 | hypothetical protein | - |
| MR221_RS17355 | 3690995..3691897 | + | 903 | WP_003409874.1 | hypothetical protein | - |
| MR221_RS17360 | 3691908..3692258 | + | 351 | WP_242363164.1 | hypothetical protein | - |
| MR221_RS17365 | 3692372..3692554 | + | 183 | WP_003409870.1 | hypothetical protein | - |
| MR221_RS17370 | 3692547..3692948 | - | 402 | WP_003409869.1 | hypothetical protein | - |
| MR221_RS17375 | 3693012..3693464 | + | 453 | WP_003899095.1 | lipoprotein | - |
| MR221_RS17380 | 3693619..3694983 | - | 1365 | WP_242363165.1 | HNH endonuclease signature motif containing protein | - |
| MR221_RS17385 | 3695038..3695628 | + | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
| MR221_RS17390 | 3695625..3696002 | + | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
| MR221_RS17395 | 3695999..3696328 | + | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| MR221_RS17400 | 3696538..3697308 | - | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
| MR221_RS17405 | 3697305..3698366 | - | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| MR221_RS17410 | 3698363..3698878 | - | 516 | WP_003409718.1 | flavin reductase family protein | - |
| MR221_RS17415 | 3698875..3699945 | - | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T295134 WP_003409778.1 NZ_OW052188:3695999-3696328 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT295134 WP_003409780.1 NZ_OW052188:3695625-3696002 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|