Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 3686747..3687291 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | parE | Uniprot ID | G0TLU9 |
Locus tag | MR221_RS17305 | Protein ID | WP_003409896.1 |
Coordinates | 3686995..3687291 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P67299 |
Locus tag | MR221_RS17300 | Protein ID | WP_003409899.1 |
Coordinates | 3686747..3686998 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS17275 | 3682474..3683271 | - | 798 | WP_003899101.1 | ABC transporter permease | - |
MR221_RS17280 | 3684170..3685390 | + | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
MR221_RS17285 | 3685423..3685695 | + | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR221_RS17290 | 3685699..3686106 | + | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
MR221_RS17295 | 3686266..3686760 | - | 495 | WP_003899099.1 | hypothetical protein | - |
MR221_RS17300 | 3686747..3686998 | + | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
MR221_RS17305 | 3686995..3687291 | + | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MR221_RS17310 | 3687340..3687954 | + | 615 | WP_003901296.1 | hypothetical protein | - |
MR221_RS17315 | 3687843..3688388 | - | 546 | WP_003409891.1 | SecB-like chaperone | - |
MR221_RS17320 | 3688385..3688834 | - | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | - |
MR221_RS17325 | 3688876..3689253 | - | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | - |
MR221_RS17330 | 3689228..3689749 | + | 522 | WP_003904745.1 | hypothetical protein | - |
MR221_RS17335 | 3689723..3690034 | - | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
MR221_RS17340 | 3690031..3690246 | - | 216 | WP_003409878.1 | antitoxin | - |
MR221_RS17345 | 3690486..3690782 | + | 297 | WP_003409877.1 | hypothetical protein | - |
MR221_RS17350 | 3690783..3690974 | + | 192 | WP_003409876.1 | hypothetical protein | - |
MR221_RS17355 | 3690995..3691897 | + | 903 | WP_003409874.1 | hypothetical protein | - |
MR221_RS17360 | 3691908..3692258 | + | 351 | WP_242363164.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11268.64 Da Isoelectric Point: 6.8604
>T295132 WP_003409896.1 NZ_OW052188:3686995-3687291 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TLU9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUZ2 |