295132

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 3686747..3687291 Replicon chromosome
Accession NZ_OW052188
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag MR221_RS17305 Protein ID WP_003409896.1
Coordinates 3686995..3687291 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag MR221_RS17300 Protein ID WP_003409899.1
Coordinates 3686747..3686998 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR221_RS17275 3682474..3683271 - 798 WP_003899101.1 ABC transporter permease -
MR221_RS17280 3684170..3685390 + 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
MR221_RS17285 3685423..3685695 + 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
MR221_RS17290 3685699..3686106 + 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
MR221_RS17295 3686266..3686760 - 495 WP_003899099.1 hypothetical protein -
MR221_RS17300 3686747..3686998 + 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
MR221_RS17305 3686995..3687291 + 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MR221_RS17310 3687340..3687954 + 615 WP_003901296.1 hypothetical protein -
MR221_RS17315 3687843..3688388 - 546 WP_003409891.1 SecB-like chaperone -
MR221_RS17320 3688385..3688834 - 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
MR221_RS17325 3688876..3689253 - 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
MR221_RS17330 3689228..3689749 + 522 WP_003904745.1 hypothetical protein -
MR221_RS17335 3689723..3690034 - 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
MR221_RS17340 3690031..3690246 - 216 WP_003409878.1 antitoxin -
MR221_RS17345 3690486..3690782 + 297 WP_003409877.1 hypothetical protein -
MR221_RS17350 3690783..3690974 + 192 WP_003409876.1 hypothetical protein -
MR221_RS17355 3690995..3691897 + 903 WP_003409874.1 hypothetical protein -
MR221_RS17360 3691908..3692258 + 351 WP_242363164.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T295132 WP_003409896.1 NZ_OW052188:3686995-3687291 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT295132 WP_003409899.1 NZ_OW052188:3686747-3686998 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References