Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mbcAT/RES-TIGR02293 |
Location | 3652836..3653734 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mbcT | Uniprot ID | P64908 |
Locus tag | MR221_RS17110 | Protein ID | WP_003410001.1 |
Coordinates | 3653174..3653734 (+) | Length | 187 a.a. |
Antitoxin (Protein)
Gene name | mbcA | Uniprot ID | P64910 |
Locus tag | MR221_RS17105 | Protein ID | WP_003410003.1 |
Coordinates | 3652836..3653177 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS17070 | 3648489..3648845 | + | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
MR221_RS17075 | 3648898..3649170 | + | 273 | WP_003903706.1 | DUF1490 family protein | - |
MR221_RS17080 | 3649167..3651482 | + | 2316 | WP_242363161.1 | cation transporter ATPase CptG | - |
MR221_RS17085 | 3651582..3651830 | + | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | - |
MR221_RS17090 | 3651824..3652168 | + | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | - |
MR221_RS17095 | 3652257..3652592 | + | 336 | WP_003410009.1 | dehydrogenase | - |
MR221_RS17100 | 3652493..3652750 | - | 258 | WP_003410006.1 | hypothetical protein | - |
MR221_RS17105 | 3652836..3653177 | + | 342 | WP_003410003.1 | DUF2384 domain-containing protein | Antitoxin |
MR221_RS17110 | 3653174..3653734 | + | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | Toxin |
MR221_RS17115 | 3654254..3654796 | - | 543 | WP_242363162.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
MR221_RS17120 | 3655022..3655450 | - | 429 | WP_003409992.1 | cellulose-binding protein | - |
MR221_RS17125 | 3655866..3656465 | - | 600 | WP_003409989.1 | L-lysine exporter | - |
MR221_RS17130 | 3656574..3657485 | + | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
MR221_RS17135 | 3657570..3657800 | - | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
MR221_RS17140 | 3657915..3658568 | + | 654 | WP_003409976.1 | cutinase Cfp21 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 187 a.a. Molecular weight: 20248.70 Da Isoelectric Point: 4.5091
>T295130 WP_003410001.1 NZ_OW052188:3653174-3653734 [Mycobacterium tuberculosis]
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
Download Length: 561 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12488.33 Da Isoelectric Point: 4.8359
>AT295130 WP_003410003.1 NZ_OW052188:3652836-3653177 [Mycobacterium tuberculosis]
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|