Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3627802..3628428 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | MR221_RS16985 | Protein ID | WP_057321105.1 |
Coordinates | 3627802..3628200 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A806JLL8 |
Locus tag | MR221_RS16990 | Protein ID | WP_003911750.1 |
Coordinates | 3628201..3628428 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS16955 | 3623401..3624657 | + | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
MR221_RS16960 | 3624785..3625375 | - | 591 | WP_003899131.1 | IS110 family transposase | - |
MR221_RS16965 | 3625329..3625949 | - | 621 | WP_003410086.1 | IS110 family transposase | - |
MR221_RS16970 | 3626037..3626216 | + | 180 | Protein_3353 | hypothetical protein | - |
MR221_RS16975 | 3626653..3627087 | - | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
MR221_RS16980 | 3627188..3627619 | + | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
MR221_RS16985 | 3627802..3628200 | - | 399 | WP_057321105.1 | PIN domain nuclease | Toxin |
MR221_RS16990 | 3628201..3628428 | - | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR221_RS16995 | 3628687..3629856 | + | 1170 | WP_003899126.1 | ATP-binding protein | - |
MR221_RS17000 | 3630045..3630389 | + | 345 | WP_003410065.1 | ferredoxin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14716.99 Da Isoelectric Point: 6.7067
>T295128 WP_057321105.1 NZ_OW052188:c3628200-3627802 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVVVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVVVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|