Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3560006..3560642 | Replicon | chromosome |
| Accession | NZ_OW052188 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | MR221_RS16695 | Protein ID | WP_003904769.1 |
| Coordinates | 3560006..3560416 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P9WJ84 |
| Locus tag | MR221_RS16700 | Protein ID | WP_003410651.1 |
| Coordinates | 3560409..3560642 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR221_RS16675 | 3555603..3556826 | + | 1224 | WP_003901321.1 | class I SAM-dependent methyltransferase | - |
| MR221_RS16680 | 3556772..3558298 | - | 1527 | WP_003410659.1 | precorrin-2 C(20)-methyltransferase | - |
| MR221_RS16685 | 3558295..3558921 | - | 627 | WP_031657419.1 | precorrin-8X methylmutase | - |
| MR221_RS16690 | 3558931..3560022 | - | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
| MR221_RS16695 | 3560006..3560416 | - | 411 | WP_003904769.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
| MR221_RS16700 | 3560409..3560642 | - | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
| MR221_RS16705 | 3560720..3564304 | + | 3585 | WP_003410648.1 | cobaltochelatase subunit CobN | - |
| MR221_RS16710 | 3564388..3564792 | + | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
| MR221_RS16715 | 3564793..3565194 | - | 402 | WP_009937711.1 | metal ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14176.35 Da Isoelectric Point: 9.4835
>T295126 WP_003904769.1 NZ_OW052188:c3560416-3560006 [Mycobacterium tuberculosis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMPAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMPAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7DU4 | |
| PDB | 6A6X | |
| AlphaFold DB | A0A7U4BV50 |