Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3516677..3517372 | Replicon | chromosome |
| Accession | NZ_OW052188 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O53501 |
| Locus tag | MR221_RS16500 | Protein ID | WP_003410811.1 |
| Coordinates | 3516938..3517372 (+) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TMN0 |
| Locus tag | MR221_RS16495 | Protein ID | WP_003410814.1 |
| Coordinates | 3516677..3516931 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR221_RS16465 | 3512025..3512219 | + | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
| MR221_RS16470 | 3512216..3513091 | + | 876 | WP_003411023.1 | proteasome subunit beta | - |
| MR221_RS16475 | 3513088..3513834 | + | 747 | WP_242363149.1 | proteasome subunit alpha | - |
| MR221_RS16480 | 3514374..3515105 | - | 732 | WP_003900467.1 | PPE family protein | - |
| MR221_RS16485 | 3515161..3515457 | - | 297 | WP_003410820.1 | PE family protein | - |
| MR221_RS16490 | 3516404..3516661 | + | 258 | WP_003410816.1 | hypothetical protein | - |
| MR221_RS16495 | 3516677..3516931 | + | 255 | WP_003410814.1 | antitoxin | Antitoxin |
| MR221_RS16500 | 3516938..3517372 | + | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR221_RS16505 | 3517351..3518184 | - | 834 | WP_242363150.1 | SWIM zinc finger family protein | - |
| MR221_RS16510 | 3518177..3521218 | - | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T295125 WP_003410811.1 NZ_OW052188:3516938-3517372 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FB09 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMN0 |