Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 3480153..3480682 Replicon chromosome
Accession NZ_OW052188
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag MR221_RS16295 Protein ID WP_003411124.1
Coordinates 3480365..3480682 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag MR221_RS16290 Protein ID WP_003411127.1
Coordinates 3480153..3480368 (+) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR221_RS16260 3475259..3476035 + 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -
MR221_RS16265 3476101..3476757 + 657 WP_242363147.1 cell division protein SepF -
MR221_RS16270 3476919..3477209 + 291 WP_003900476.1 YggT family protein -
MR221_RS16275 3477477..3478259 + 783 WP_003411131.1 cell wall synthesis protein Wag31 -
MR221_RS16280 3478354..3478710 + 357 WP_003411130.1 hypothetical protein -
MR221_RS16285 3478840..3479898 - 1059 WP_003411129.1 phosphoribosyltransferase family protein -
MR221_RS16290 3480153..3480368 + 216 WP_003411127.1 antitoxin ParD2 Antitoxin
MR221_RS16295 3480365..3480682 + 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MR221_RS16305 3481095..3482441 + 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
MR221_RS16310 3482489..3483019 + 531 WP_003904790.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
MR221_RS16315 3483024..3484097 - 1074 WP_003411116.1 quinone-dependent dihydroorotate dehydrogenase -
MR221_RS16320 3484133..3484414 - 282 WP_003411112.1 DUF5703 family protein -
MR221_RS16325 3484411..3485487 - 1077 WP_003904789.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T295124 WP_003411124.1 NZ_OW052188:3480365-3480682 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT295124 WP_003411127.1 NZ_OW052188:3480153-3480368 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References