Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 3014500..3015209 | Replicon | chromosome |
| Accession | NZ_OW052188 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ26 |
| Locus tag | MR221_RS14105 | Protein ID | WP_003413164.1 |
| Coordinates | 3014796..3015209 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | MR221_RS14100 | Protein ID | WP_003413167.1 |
| Coordinates | 3014500..3014757 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR221_RS14060 | 3009593..3010105 | + | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
| MR221_RS14065 | 3010098..3011351 | + | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
| MR221_RS14070 | 3011348..3012157 | + | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
| MR221_RS14075 | 3012169..3012588 | + | 420 | WP_003413190.1 | A24 family peptidase | - |
| MR221_RS14080 | 3012999..3013244 | + | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| MR221_RS14085 | 3013241..3013636 | + | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| MR221_RS14090 | 3013736..3014110 | + | 375 | WP_003413177.1 | hypothetical protein | - |
| MR221_RS14095 | 3014126..3014503 | - | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR221_RS14100 | 3014500..3014757 | - | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
| MR221_RS14105 | 3014796..3015209 | - | 414 | WP_003413164.1 | PIN domain nuclease | Toxin |
| MR221_RS14110 | 3015302..3015580 | - | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| MR221_RS14115 | 3015577..3016239 | - | 663 | WP_003900848.1 | LppA family lipoprotein | - |
| MR221_RS14120 | 3016236..3016895 | - | 660 | WP_003900847.1 | LppA family lipoprotein | - |
| MR221_RS14125 | 3016892..3017551 | - | 660 | WP_003900846.1 | LppA family lipoprotein | - |
| MR221_RS14130 | 3017678..3018889 | - | 1212 | WP_242363138.1 | alpha/beta hydrolase family protein | - |
| MR221_RS14135 | 3018778..3019185 | - | 408 | WP_242363139.1 | hypothetical protein | - |
| MR221_RS14140 | 3019185..3019499 | - | 315 | WP_009937839.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15045.00 Da Isoelectric Point: 5.4673
>T295121 WP_003413164.1 NZ_OW052188:c3015209-3014796 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ26 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |