295121

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 3014500..3015209 Replicon chromosome
Accession NZ_OW052188
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag MR221_RS14105 Protein ID WP_003413164.1
Coordinates 3014796..3015209 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag MR221_RS14100 Protein ID WP_003413167.1
Coordinates 3014500..3014757 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR221_RS14060 3009593..3010105 + 513 WP_003413197.1 Holliday junction resolvase RuvX -
MR221_RS14065 3010098..3011351 + 1254 WP_003413196.1 endolytic transglycosylase MltG -
MR221_RS14070 3011348..3012157 + 810 WP_003413193.1 shikimate dehydrogenase -
MR221_RS14075 3012169..3012588 + 420 WP_003413190.1 A24 family peptidase -
MR221_RS14080 3012999..3013244 + 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
MR221_RS14085 3013241..3013636 + 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
MR221_RS14090 3013736..3014110 + 375 WP_003413177.1 hypothetical protein -
MR221_RS14095 3014126..3014503 - 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
MR221_RS14100 3014500..3014757 - 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
MR221_RS14105 3014796..3015209 - 414 WP_003413164.1 PIN domain nuclease Toxin
MR221_RS14110 3015302..3015580 - 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
MR221_RS14115 3015577..3016239 - 663 WP_003900848.1 LppA family lipoprotein -
MR221_RS14120 3016236..3016895 - 660 WP_003900847.1 LppA family lipoprotein -
MR221_RS14125 3016892..3017551 - 660 WP_003900846.1 LppA family lipoprotein -
MR221_RS14130 3017678..3018889 - 1212 WP_242363138.1 alpha/beta hydrolase family protein -
MR221_RS14135 3018778..3019185 - 408 WP_242363139.1 hypothetical protein -
MR221_RS14140 3019185..3019499 - 315 WP_009937839.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T295121 WP_003413164.1 NZ_OW052188:c3015209-3014796 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT295121 WP_003413167.1 NZ_OW052188:c3014757-3014500 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References