Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2952570..2953284 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | MR221_RS13820 | Protein ID | WP_003413460.1 |
Coordinates | 2952570..2953010 (-) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ20 |
Locus tag | MR221_RS13825 | Protein ID | WP_003413456.1 |
Coordinates | 2952997..2953284 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS13795 | 2948482..2949156 | - | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
MR221_RS13800 | 2949284..2950183 | + | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
MR221_RS13805 | 2950212..2951057 | + | 846 | WP_003413466.1 | acyl-CoA thioesterase II | - |
MR221_RS13810 | 2951065..2951661 | + | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
MR221_RS13815 | 2951794..2952549 | + | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
MR221_RS13820 | 2952570..2953010 | - | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR221_RS13825 | 2952997..2953284 | - | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
MR221_RS13830 | 2953395..2954966 | - | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
MR221_RS13835 | 2954963..2955421 | - | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
MR221_RS13840 | 2955446..2955877 | - | 432 | WP_003413445.1 | DUF4247 domain-containing protein | - |
MR221_RS13845 | 2955874..2956368 | - | 495 | WP_003413444.1 | DUF2617 family protein | - |
MR221_RS13850 | 2956379..2956999 | - | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
MR221_RS13855 | 2957216..2957620 | - | 405 | WP_003413432.1 | type II toxin-antitoxin system VapC family toxin | - |
MR221_RS13860 | 2957617..2957862 | - | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T295118 WP_003413460.1 NZ_OW052188:c2953010-2952570 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BWB8 |