Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2823009..2823696 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TF65 |
Locus tag | MR221_RS13055 | Protein ID | WP_003414064.1 |
Coordinates | 2823009..2823404 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | MR221_RS13060 | Protein ID | WP_003414061.1 |
Coordinates | 2823430..2823696 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS13020 | 2818906..2819643 | - | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
MR221_RS13025 | 2819799..2820599 | + | 801 | WP_003911953.1 | thymidylate synthase | - |
MR221_RS13030 | 2820670..2821149 | + | 480 | WP_003414073.1 | dihydrofolate reductase | - |
MR221_RS13035 | 2821150..2821224 | - | 75 | Protein_2578 | hypothetical protein | - |
MR221_RS13040 | 2821223..2821642 | + | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
MR221_RS13045 | 2821639..2822733 | + | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
MR221_RS13050 | 2822743..2823012 | + | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MR221_RS13055 | 2823009..2823404 | + | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR221_RS13060 | 2823430..2823696 | + | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR221_RS13065 | 2823693..2824109 | + | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
MR221_RS13070 | 2824196..2825818 | + | 1623 | WP_242363130.1 | class I SAM-dependent DNA methyltransferase | - |
MR221_RS13075 | 2825815..2826090 | + | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
MR221_RS13085 | 2826334..2827086 | + | 753 | WP_031657460.1 | FAD-dependent thymidylate synthase | - |
MR221_RS13090 | 2827155..2828057 | + | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T295116 WP_003414064.1 NZ_OW052188:2823009-2823404 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|