Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2783540..2784110 | Replicon | chromosome |
| Accession | NZ_OW052188 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | MR221_RS12835 | Protein ID | WP_003414166.1 |
| Coordinates | 2783754..2784110 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | MR221_RS12830 | Protein ID | WP_003901465.1 |
| Coordinates | 2783540..2783770 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR221_RS12790 | 2778558..2778869 | - | 312 | WP_003414190.1 | hypothetical protein | - |
| MR221_RS12795 | 2778974..2779231 | - | 258 | WP_003899489.1 | hypothetical protein | - |
| MR221_RS12800 | 2780341..2780601 | - | 261 | Protein_2531 | transposase | - |
| MR221_RS12805 | 2780818..2781009 | - | 192 | WP_003414184.1 | hypothetical protein | - |
| MR221_RS12810 | 2781006..2781410 | - | 405 | WP_003414181.1 | hypothetical protein | - |
| MR221_RS12815 | 2781558..2781812 | + | 255 | WP_003917684.1 | hypothetical protein | - |
| MR221_RS12820 | 2781988..2782455 | - | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
| MR221_RS12825 | 2782454..2783497 | + | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| MR221_RS12830 | 2783540..2783770 | + | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
| MR221_RS12835 | 2783754..2784110 | + | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| MR221_RS12840 | 2784212..2785861 | - | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
| MR221_RS12845 | 2785880..2786467 | - | 588 | WP_003914429.1 | DUF3558 family protein | - |
| MR221_RS12850 | 2786640..2786966 | + | 327 | WP_003414157.1 | hypothetical protein | - |
| MR221_RS12855 | 2786970..2788658 | + | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T295115 WP_003414166.1 NZ_OW052188:2783754-2784110 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|