Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2185274..2185948 Replicon chromosome
Accession NZ_OW052188
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag MR221_RS10095 Protein ID WP_003417282.1
Coordinates 2185520..2185948 (+) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag MR221_RS10090 Protein ID WP_003417286.1
Coordinates 2185274..2185516 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR221_RS10065 2181738..2182874 + 1137 WP_003417297.1 GTP 3',8-cyclase MoaA -
MR221_RS10070 2182971..2183345 + 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
MR221_RS10075 2183342..2183875 + 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
MR221_RS10080 2183876..2184541 + 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
MR221_RS10085 2184538..2185152 + 615 WP_003417288.1 class I SAM-dependent methyltransferase -
MR221_RS10090 2185274..2185516 + 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
MR221_RS10095 2185520..2185948 + 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
MR221_RS10100 2186027..2186818 - 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
MR221_RS10105 2186818..2188590 - 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
MR221_RS10110 2188719..2189153 - 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
MR221_RS10115 2189150..2189488 - 339 WP_003904248.1 succinate dehydrogenase, cytochrome b556 subunit -
MR221_RS10120 2189725..2190126 + 402 WP_003417264.1 cytidine deaminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T295109 WP_003417282.1 NZ_OW052188:2185520-2185948 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT295109 WP_003417286.1 NZ_OW052188:2185274-2185516 [Mycobacterium tuberculosis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References