Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 2090465..2091132 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O50411 |
Locus tag | MR221_RS09770 | Protein ID | WP_003417916.1 |
Coordinates | 2090740..2091132 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
Locus tag | MR221_RS09765 | Protein ID | WP_003912214.1 |
Coordinates | 2090465..2090740 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS09750 | 2085509..2086381 | + | 873 | WP_003417929.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
MR221_RS09755 | 2086452..2088722 | - | 2271 | WP_031653948.1 | PE family protein | - |
MR221_RS09760 | 2088912..2090283 | - | 1372 | Protein_1927 | ISNCY family transposase | - |
MR221_RS09765 | 2090465..2090740 | + | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MR221_RS09770 | 2090740..2091132 | + | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR221_RS09775 | 2091886..2092938 | + | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
MR221_RS09780 | 2092938..2093927 | + | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
MR221_RS09785 | 2093924..2095762 | + | 1839 | WP_019830554.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2088912..2089589 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T295107 WP_003417916.1 NZ_OW052188:2090740-2091132 [Mycobacterium tuberculosis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BXS8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E8U8S7 |