Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
| Location | 1112991..1113517 | Replicon | chromosome |
| Accession | NZ_OW052188 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | Rv0299 | Uniprot ID | - |
| Locus tag | MR221_RS05365 | Protein ID | WP_003401560.1 |
| Coordinates | 1112991..1113293 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | Rv0298 | Uniprot ID | P9WJ08 |
| Locus tag | MR221_RS05370 | Protein ID | WP_003401555.1 |
| Coordinates | 1113290..1113517 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR221_RS05345 | 1110627..1111535 | - | 909 | WP_242363249.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| MR221_RS05350 | 1111532..1112164 | - | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
| MR221_RS05355 | 1112300..1112725 | - | 426 | WP_003401566.1 | PIN domain nuclease | - |
| MR221_RS05360 | 1112722..1112943 | - | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | - |
| MR221_RS05365 | 1112991..1113293 | - | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
| MR221_RS05370 | 1113290..1113517 | - | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| MR221_RS05375 | 1113660..1115480 | - | 1821 | WP_031653699.1 | PE family protein | - |
| MR221_RS05380 | 1115659..1117056 | + | 1398 | WP_003401544.1 | sulfatase | - |
| MR221_RS05385 | 1117066..1117869 | + | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T295104 WP_003401560.1 NZ_OW052188:c1113293-1112991 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|