Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 780743..781389 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O07783 |
Locus tag | MR221_RS03845 | Protein ID | WP_003403122.1 |
Coordinates | 780997..781389 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ86 |
Locus tag | MR221_RS03840 | Protein ID | WP_003403125.1 |
Coordinates | 780743..781000 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS03805 | 776061..776372 | - | 312 | WP_003403164.1 | hypothetical protein | - |
MR221_RS03810 | 776495..777190 | + | 696 | WP_200861092.1 | two-component system response regulator TcrA | - |
MR221_RS03815 | 777174..777704 | + | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
MR221_RS03820 | 777818..778324 | + | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
MR221_RS03825 | 778428..778664 | + | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | - |
MR221_RS03830 | 778661..779074 | + | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
MR221_RS03835 | 779325..780560 | + | 1236 | WP_003403128.1 | ATP-binding protein | - |
MR221_RS03840 | 780743..781000 | + | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
MR221_RS03845 | 780997..781389 | + | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
MR221_RS03850 | 781441..782991 | - | 1551 | WP_003403119.1 | MlaD family protein | - |
MR221_RS03855 | 782996..784138 | - | 1143 | WP_003911253.1 | virulence factor Mce family protein | - |
MR221_RS03860 | 784201..785727 | - | 1527 | WP_003403112.1 | virulence factor Mce family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T295098 WP_003403122.1 NZ_OW052188:780997-781389 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F8V4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ86 |