295097

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 778428..779074 Replicon chromosome
Accession NZ_OW052188
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag MR221_RS03830 Protein ID WP_003403137.1
Coordinates 778661..779074 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag MR221_RS03825 Protein ID WP_003403139.1
Coordinates 778428..778664 (+) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR221_RS03790 773502..774212 - 711 Protein_744 IS607 family element RNA-guided endonuclease TnpB -
MR221_RS03795 774214..774798 - 585 WP_003403171.1 IS607-like element IS1536 family transposase -
MR221_RS03800 775039..775989 - 951 WP_003907436.1 DUF1259 domain-containing protein -
MR221_RS03805 776061..776372 - 312 WP_003403164.1 hypothetical protein -
MR221_RS03810 776495..777190 + 696 WP_200861092.1 two-component system response regulator TcrA -
MR221_RS03815 777174..777704 + 531 WP_003917320.1 two component system sensor kinase HK2 -
MR221_RS03820 777818..778324 + 507 WP_003900973.1 two component system sensor kinase HK1 -
MR221_RS03825 778428..778664 + 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
MR221_RS03830 778661..779074 + 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
MR221_RS03835 779325..780560 + 1236 WP_003403128.1 ATP-binding protein -
MR221_RS03840 780743..781000 + 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
MR221_RS03845 780997..781389 + 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
MR221_RS03850 781441..782991 - 1551 WP_003403119.1 MlaD family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T295097 WP_003403137.1 NZ_OW052188:778661-779074 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT295097 WP_003403139.1 NZ_OW052188:778428-778664 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References