Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 772341..772984 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67239 |
Locus tag | MR221_RS03775 | Protein ID | WP_003403187.1 |
Coordinates | 772341..772742 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ91 |
Locus tag | MR221_RS03780 | Protein ID | WP_003403184.1 |
Coordinates | 772739..772984 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS03750 | 769299..769904 | - | 606 | WP_003898526.1 | hypothetical protein | - |
MR221_RS03755 | 770046..770267 | + | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
MR221_RS03760 | 770319..771476 | + | 1158 | Protein_738 | hypothetical protein | - |
MR221_RS03765 | 771556..771753 | + | 198 | WP_003403191.1 | hypothetical protein | - |
MR221_RS03770 | 772171..772350 | - | 180 | Protein_740 | hypothetical protein | - |
MR221_RS03775 | 772341..772742 | - | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR221_RS03780 | 772739..772984 | - | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR221_RS03785 | 773029..773499 | - | 471 | WP_003898523.1 | hypothetical protein | - |
MR221_RS03790 | 773502..774212 | - | 711 | Protein_744 | IS607 family element RNA-guided endonuclease TnpB | - |
MR221_RS03795 | 774214..774798 | - | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
MR221_RS03800 | 775039..775989 | - | 951 | WP_003907436.1 | DUF1259 domain-containing protein | - |
MR221_RS03805 | 776061..776372 | - | 312 | WP_003403164.1 | hypothetical protein | - |
MR221_RS03810 | 776495..777190 | + | 696 | WP_200861092.1 | two-component system response regulator TcrA | - |
MR221_RS03815 | 777174..777704 | + | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T295096 WP_003403187.1 NZ_OW052188:c772742-772341 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSD6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ91 |