Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 764821..765446 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | MR221_RS03725 | Protein ID | WP_003403218.1 |
Coordinates | 764821..765222 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ36 |
Locus tag | MR221_RS03730 | Protein ID | WP_003403213.1 |
Coordinates | 765219..765446 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS03700 | 759910..760857 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
MR221_RS03705 | 760868..762025 | - | 1158 | WP_003903091.1 | hypothetical protein | - |
MR221_RS03710 | 762420..763511 | - | 1092 | WP_242363226.1 | galactokinase | - |
MR221_RS03715 | 763508..764590 | - | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
MR221_RS03720 | 764609..764692 | - | 84 | Protein_730 | galactose-1-phosphate uridylyltransferase | - |
MR221_RS03725 | 764821..765222 | - | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
MR221_RS03730 | 765219..765446 | - | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
MR221_RS03735 | 765641..765883 | - | 243 | WP_003403210.1 | hypothetical protein | - |
MR221_RS03740 | 765880..766629 | - | 750 | WP_003898528.1 | hypothetical protein | - |
MR221_RS03745 | 766713..769280 | + | 2568 | WP_003900188.1 | SEC-C metal-binding domain-containing protein | - |
MR221_RS03750 | 769299..769904 | - | 606 | WP_003898526.1 | hypothetical protein | - |
MR221_RS03755 | 770046..770267 | + | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T295095 WP_003403218.1 NZ_OW052188:c765222-764821 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC9 |