Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 757538..758202 | Replicon | chromosome |
Accession | NZ_OW052188 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P96917 |
Locus tag | MR221_RS03675 | Protein ID | WP_003403246.1 |
Coordinates | 757538..757945 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WF18 |
Locus tag | MR221_RS03680 | Protein ID | WP_003403244.1 |
Coordinates | 757942..758202 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR221_RS03665 | 754495..756222 | + | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
MR221_RS03670 | 756315..757466 | + | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
MR221_RS03675 | 757538..757945 | - | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR221_RS03680 | 757942..758202 | - | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MR221_RS03685 | 758334..759074 | + | 741 | WP_242363225.1 | TVP38/TMEM64 family protein | - |
MR221_RS03690 | 759168..759563 | - | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
MR221_RS03695 | 759563..759817 | - | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
MR221_RS03700 | 759910..760857 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
MR221_RS03705 | 760868..762025 | - | 1158 | WP_003903091.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T295093 WP_003403246.1 NZ_OW052188:c757945-757538 [Mycobacterium tuberculosis]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|