295092

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 722077..722710 Replicon chromosome
Accession NZ_OW052188
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag MR221_RS03505 Protein ID WP_003403365.1
Coordinates 722327..722710 (+) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag MR221_RS03500 Protein ID WP_003403368.1
Coordinates 722077..722232 (+) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR221_RS03470 717194..719557 - 2364 WP_003403397.1 arylsulfatase AtsD -
MR221_RS03475 719671..719925 + 255 WP_003911263.1 antitoxin VapB7 -
MR221_RS03480 719922..720359 + 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
MR221_RS03485 720469..720714 + 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
MR221_RS03490 720701..721009 + 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
MR221_RS03495 721285..722001 + 717 WP_003903122.1 CPBP family intramembrane metalloprotease -
MR221_RS03500 722077..722232 + 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR221_RS03505 722327..722710 + 384 WP_003403365.1 ribonuclease VapC6 Toxin
MR221_RS03510 723098..724108 - 1011 WP_031653722.1 ABC transporter ATP-binding protein -
MR221_RS03515 724189..725694 - 1506 WP_003403360.1 carotenoid cleavage oxygenase -
MR221_RS03520 725765..726460 + 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
MR221_RS03525 726453..726845 - 393 WP_003403353.1 50S ribosomal protein L7/L12 -
MR221_RS03530 726882..727418 - 537 WP_003403341.1 50S ribosomal protein L10 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T295092 WP_003403365.1 NZ_OW052188:722327-722710 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT295092 WP_003403368.1 NZ_OW052188:722077-722232 [Mycobacterium tuberculosis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References